• Post Reply Bookmark Topic Watch Topic
  • New Topic
programming forums Java Mobile Certification Databases Caching Books Engineering Micro Controllers OS Languages Paradigms IDEs Build Tools Frameworks Application Servers Open Source This Site Careers Other all forums
this forum made possible by our volunteer staff, including ...
Marshals:
  • Campbell Ritchie
  • Liutauras Vilda
  • Bear Bibeault
  • Paul Clapham
  • Jeanne Boyarsky
Sheriffs:
  • Junilu Lacar
  • Knute Snortum
  • Henry Wong
Saloon Keepers:
  • Ron McLeod
  • Tim Moores
  • Stephan van Hulst
  • Tim Holloway
  • Carey Brown
Bartenders:
  • Frits Walraven
  • Joe Ess
  • salvin francis

Introduce thyself....the funny way

 
Rancher
Posts: 1369
1
Android Eclipse IDE Java
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
Imagine a meeting, where you are required to introduce yourself..what is the best introduction(humorous) you can think of??

Hi..I am Monu...my hobbies include Snake charming..i brought a snake too; lost it somewhere in the meeting room!

[ December 06, 2008: Message edited by: Monu Tripathi ]
[ December 06, 2008: Message edited by: Bear Bibeault ]
 
Ranch Hand
Posts: 2937
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
Damn, I am in the wrong meeting room!
 
author
Posts: 5856
7
Android Eclipse IDE Ubuntu
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
Several years ago I took this class on team building where the instructor, during the typical "introduce yourself" section asked us to also state "If you were and animal, what animal would you be and why?" Of course, other mentioned things like souring eagles, majestic lions and whatnot. Why it was my turn, I simply stated:

I would be a Pikachu because it would competely thrill my daughters!
 
Ranch Hand
Posts: 630
Android Java Linux
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
Hi,My First name is Adolph Blaine Charles David Earl Frederick Gerald Hubert Irvim John Kenneth Loyd Martin Nero Oliver Paul Quincy Randolph Sherman Thomas Uncas Victor Willian Xerxes Yancy Zeus
& last name is
Wolfeschlegelsteinhausenbergerdorffvoralternwarengewissenhaf
tschaferswesenchafewarenwholgepflegeundsorgfaltigkeitbeschut
zenvonangereifenduchihrraubgiriigfeindewelchevorralternzwolf
tausendjahresvorandieerscheinenbanderersteerdeemmeshedrraums
chiffgebrauchlichtalsseinursprungvonkraftgestartseinlangefah
rthinzwischensternartigraumaufdersuchenachdiesternwelshegeha
btbewohnbarplanetenkreisedrehensichundwohinderneurassevanver
standigmenshlichkeittkonntevortpflanzenundsicherfreunanleben
slamdlichfreudeundruhemitnichteinfurchtvorangreifenvonandere
rintlligentgeschopfsvonhinzwischensternartigraum.
I am from
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
& i will explain you in this meeting uses of enzyme which name is
methionylglutaminylarginyltyrosylglutamylserylleucylphenylal
anylalanylglutaminylleucyllysylglutamylarginyllysylglutamylg
lycylalanylphenylalanylvalylprolylphenylalanylvalylthreonyll
eucylglycylaspartylprolylglycylisoleucylglutamylglutaminylse
rylleucyllysylisoleucylaspartylthreonylleucylisoleucylglutam
ylalanylglycylalanylaspartylalanylleucylglutamylleucylglycyl
isoleucylprolylphenylalanylserylaspartylprolylleucylalanylas
partylglycylprolylthreonylisoleucylglutaminylasparaginylalan
ylthreonylleucylarginylalanylphenylalanylalanylalanylglycylv
alylthreonylprolylalanylglutaminylcysteinylphenylalanylgluta
mylmethionylleucylalanylleucylisoleucylarginylglutaminyllysy
lhistidylprolylthreonylisoleucylprolylisoleucylglycylleucyll
eucylmethionyltyrosylalanylasparaginylleucylvalylphenylalany
lasparaginyllysylglycylisoleucylaspartylglutamylphenylalanyl
tyrosylalanylglutaminylcysteinylglutamyllysylvalylglycylvaly
laspartylserylvalylleucylvalylalanylaspartylvalylprolylvalyl
glutaminylglutamylserylalanylprolylphenylalanylarginylglutam
inylalanylalanylleucylarginylhistidylasparaginylvalylalanylp
rolylisoleucylphenylalanylisoleucylcysteinylprolylprolylaspa
rtylalanylaspartylaspartylaspartylleucylleucylarginylglutami
nylisoleucylalanylseryltyrosylglycylarginylglycyltyrosylthre
onyltyrosylleucylleucylserylarginylalanylglycylvalylthreonyl
glycylalanylglutamylasparaginylarginylalanylalanylleucylprol
ylleucylasparaginylhistidylleucylvalylalanyllysylleucyllysyl
glutamyltyrosylasparaginylalanylalanylprolylprolylleucylglut
aminylglycylphenylalanylglycylisoleucylserylalanylprolylaspa
rtylglutaminylvalyllysylalanylalanylisoleucylaspartylalanylg
lycylalanylalanylglycylalanylisoleucylserylglycylserylalanyl
isoleucylvalyllysylisoleucylisoleucylglutamylglutaminylhisti
dylasparaginylisoleucylglutamylprolylglutamyllysylmethionyll
eucylalanylalanylleucyllysylvalylphenylalanylvalylglutaminyl
prolylmethionyllysylalanylalanylthreonylarginylserine.
 
Ranch Hand
Posts: 1710
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
I name is ... You all know my name already so not to tell
I would like to talk about ... (seems all are genius technocrat here so
to name topic would be unfair here.

Purpose of this meeting is to ... Frankly telling is just time pass.
Anyways to make this meeting meaningful I would like to start... Its boring
na?

Ok let me say something... Now I feel bored... Don't you.
But with respect to this meeting... I ought to say something...
But what to say...

Thank You all for your patience. Please mail your feedback so that we could
implement this concept in our ongoing project.

 
Ranch Hand
Posts: 294
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
Hi. My name is blah blah blah blah.

I hear public speaking is easier when you imagine your audience is in their underwear. I'm glad to see that everyone is wearing clean underwear today.


- Doug
- Nothing is impossible if I'mPossible
 
author and iconoclast
Posts: 24203
43
Mac OS X Eclipse IDE Chrome
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
I often start meetings by shouting

EVERYONE. STOP. TALKING. AND. LISTEN. TO. ME.
 
Sheriff
Posts: 11343
Mac Safari Java
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
Uh, I'm just wondering... Why is everyone on third floor naked today?
 
Ranch Hand
Posts: 392
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
oooh gosh i need to sit around you guys today!!!
 
Ranch Hand
Posts: 1609
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
Dear friends,
I have a good news and a bad news for you all.

The good news is that there is no bad news and the bad news is that there is no good news.

I am a newsteller not news-letter
[ December 10, 2008: Message edited by: Akhilesh Trivedi ]
 
marc weber
Sheriff
Posts: 11343
Mac Safari Java
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
Introduce yourself as the person sitting next to you, and then explain that you're clearly "not yourself" today.
 
Monu Tripathi
Rancher
Posts: 1369
1
Android Eclipse IDE Java
  • Mark post as helpful
  • send pies
  • Quote
  • Report post to moderator
My name is Gladiator

OR

Distribute printouts of (an essay on) myself and direct them to blogs for further reading..
[ December 11, 2008: Message edited by: Monu Tripathi ]
 
You save more money with a clothesline than dozens of light bulb purchases. Tiny ad:
Sauce Labs - World's Largest Continuous Testing Cloud for Websites and Mobile Apps
https://coderanch.com/t/722574/Sauce-Labs-World-Largest-Continuous
  • Post Reply Bookmark Topic Watch Topic
  • New Topic
Boost this thread!