Nananana

[Ernest Friedman-Hill]

nananananananananananana

[marc weber]

I get it. That's anananananananananananan spelled backwards. :roll:

[Ernest Friedman-Hill]

Really, really really not a number.

[Stan James]

Hey, hey, hey,
Goodbye

[Ashok Mash]

'Here I am, brain the size of a planet, and they ask me to...'

h2g2

[David O'Meara]

Batman!

[Christophe Verré]

I get it. That's anananananananananananan spelled backwards.

Nope, I got it. That's ueueueueueueueueueueueue looked from above.

[marc weber]

Originally posted by Christophe Verre:
... That's ueueueueueueueueueueueue looked from above.

[S Venkatesh]

Originally posted by Ernest Friedman-Hill:
nananananananananananana

thats from an infant infant learning to speak

[David O'Meara]

it is possible that this is 'lalala' and not 'nanana'

[Jim Yingst]

Naaaa... na na na-na-na-naaa!
Na-na-na-naaaa!
Hey Jude!

[v ray]

Originally posted by Christophe Verre:

Nope, I got it. That's ueueueueueueueueueueueue looked from above.

Somehow my girlfriend learnt to make that sound, all credit to me .

[siva kumar]

Hi Guys...

What are you talking in code or something.............

[Jim Yingst]

We could be Nanana code talkers.

[David O'Meara]

Knights that say 'Na'?

[Burkhard Hassel]

The Beatles?

[Hussein Baghdadi]

Or it could be from Kelly's Clarkson song: "Breakaway".

[Mansur Khan]

Blah blah blah blah :roll:

[David O'Meara]

Originally posted by Mansur Khan:
Blah blah blah blah :roll:

Can you hum a few bars?

[Ernest Friedman-Hill]

I feel very proud.

[Ulf Dittmer]

Originally posted by Ernest Friedman-Hill:
I feel very proud.

And rightly so. I'd say in starting MD threads you're up there with the best of them.

[fred rosenberger]

Originally posted by Ernest Friedman-Hill:
Really, really really not a number.

how does that work? there's no 'n' on the end. all you have is not a not a not a... not a.

or, you have not a number a number a number... a number a.

[Jim Yingst]

[Burkhard]: The Beatles?

Well, that's what I was going for, yes. (Highlight the "blank" third line in my last post to see.) EFH has one extra "na" in his post, but I think that's obviously a mistake on his part, don't you?

Incidentally, I think the timings are a bit off in your notation:



I would say that should be:

bar

half note
quarter note
quarter note

bar

sixteenth note
sixteenth note
eighth note
half note
quarter rest

bar

sixteenth note
sixteenth note
eighth note
half note
quarter note

bar

half note
half rest

(repeat)
[ July 20, 2007: Message edited by: Jim Yingst ]

[marc weber]

Originally posted by Ernest Friedman-Hill:
nananananananananananana

This appears to be the amino acid sequence for one of the mutated segments of the gene that predisposes individuals to Meaningless Drivel. These aberrations manifest in myriad ways, including an inexplicable (and highly communicable) tenancy to ascribe melody to seemingly random syllables. Fortunately, I have proven myself immune to the lure of driveling in any form. :roll:

[Jim Yingst]

What seemingly random syllables? Those are the actual lyrics!

[Sayak Banerjee]

Originally posted by Ernest Friedman-Hill:
nananananananananananana

I smell Roxette here.

[Bert Bates]

na-na na-na naaa-na
na-na na-na naaa-na

you dooty-head

[Stan James]

Oh, well, the rhythm gave it away. Try the Don Ellis arrangement and see if it doesn't take longer than this to guess the tune.
[ July 20, 2007: Message edited by: Stan James ]

[Marc Peabody]

That's the noise I make so I sink my putts!

[Burkhard Hassel]

Jim, for the additional na I left the extra bar at the end.

Yes, the rhythm was wrong. But I've never been to Liverpool to my excuse.
But the revised version


still sounds a bit odd.
(Midi file 0.00017833709716796875 MB)



marc weber posted

This appears to be the amino acid sequence for one of the mutated segments of the gene that predisposes individuals to Meaningless Drivel.

The poly asparagine-alanine sequence is found in an outer membrane protein of the marine bacterium Vibrio fischeri. But I don't know what it does there.
It can also be found in bacterial NUDIX hydrolase. This is not a unix variant but an enzyme that hydrolyses organic pyrophospates (including for example ATP).
NANANANANANANANANANANANA can also be found near the amino terminus of cobyric acid synthase of the gram negative bacterium Burkholderia thailandensis and somewhere in the middle of the large subunit of Methylmalonyl-CoA mutase. Of the latter I show the amino acid sequence:

MTDLSTPQRAGSHKLPAGRRLRFVTAAALFDGHDASINIMRRILQASGVEVIHLGHNRSV
DEVATAALQEDADGVAVSSYQGGHNEYFRYLVDLLRARGGERIKVFGGGGGVIVPEEISE
LESYGVEKIYSPQDGQRLGLQGMIDDMIARCAEGARAAEAVGQSRVGEWVDEFSKRGLPR
FDSRGDAGGDEDAVRNPFSQASHVGCATSVGHVANAADTADAADTADTADAADTADAADT
ADTADTADTAIAANTANTANTANTANTANTANTANTSDPASSTFRRLAQLISAFEAGAVD
ASAREKLSAQAQAKATATPVLGITGTGGAGKSSLTDELIRRFRLDYGDALTIAVLAIDPS
RRKSGGALLGDRIRMNAIGDWGGGARVYMRSMATREASSEVSDSLPDALMLCKAAGFDLI
VVETSGIGQGNAAIVPFVDESLYVMTPEFGAASQLEKIDMLDFAGFVAINKFDRKGAPDA
LRDVAKQVQRNRADFAKPPEAMPVFGTIASRFNDDGVTALYRHVAEALRKHGLRSGGGRL
AAPEGLRFSSGRNAIVPPARVRYLADIAQTIHAYRERADAQARLARERWQLVEARRMLGE
AGTQAGAVTQSRASASGNSSGNPNANSDADSDADSDA[B]NANANANANANANANANANANAN
ANANANA[/B]SANANSNPDPNSNKHAPANVTSADTPSPLQQLDTLIAQRTASLGERERALLDT
WPQTVAAYSGAEHIVRIRDREIRTALTVTTLSGSEVRKVSLPKFADHGEILRWLMLDNLP
GYFPFTAGVFPFRRENEDPTRMFAGEGDPQRTNRRFKLLSEGMPAKRLSTAFDSVTLYGE
EPDERPDIYGKVGNSGVSVATLDDMKTLYDGFDLCAPETSVSMTINGPAPTILAMFFNVA
IDQQIARMTQQQGRPLTHDELSATRRAALENVRGTVQADILKEDQGQNTCIFSTEFSLKV
MGDIQAYFVEHGVRNFYSVSISGYHIAEAGANPISQLAYTLANGFTYVEAYLARGMSIDD
FAPNLSFFFSNGMDPEYTVLGRVARRIWAVAMRERYGANERSQKLKYHVQTSGRSLHAQE
IDFNDIRTTLQALIAIYDNCNSLHTNAFDEAITTPTEDSVRRAVAIQLIINREWGLAKNQ
NPNQGSFVIEELTDLVEEAVLAEFDRLTERGGVLGAMETGYQRGRIQDESMLYEHRKHDG
SYPIVGVNTFLSAHPHEAPQPIALARSTDDEKQSQLQRLRAFQSQHRDAAPAALERLKRA
VIDDENVFAVLMDVVRVCSLGQITHALFEVGGQYRRNM

As you see here's the nana sequence a bit longer that the Friedman-Hill-variant (NANA-FH). The enzyme is also part of the human proteome, but in humans the NANA sequence is not conserved:

Query  616   SGNSSGNPNAN--SDADSDADSDABNANANANANANANANANANANANANANANABSANA  673
             + NSSG P     +D  S +D   ++  A A+ +  ++  ANA  +   N      + + 
Sbjct  987   ASNSSGVPFCYFVNDLYSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHK  1046
 

Query = from bug, Sbjct = human



By the way, did anyone of you just google the nana?

Yours,
Bu.

[ July 21, 2007: Message edited by: Burkhard Hassel ]
[ July 21, 2007: Message edited by: Burkhard Hassel ]

[Vassili Vladimir]

Life is life, nanananana ...

[Burkhard Hassel]

No Vassili,
with Life is Life you only have 41.66% of the nas required.
Bu.
[ July 21, 2007: Message edited by: Burkhard Hassel ]

[Ben Souther]

And another world religion is spwaned and the newly formed Nananians begin their quest to find the meaning in the utterances brought forth by the prophet EFH.
[ July 21, 2007: Message edited by: Ben Souther ]

[Burkhard Hassel]

Look how the icon of the nanaians look like:
http://fr.wikipedia.org/wiki/Nana_(Niki_de_Saint-Phalle)

Bu.

[Jim Yingst]

[Burkhard Hassel]: But the revised version


still sounds a bit odd.

Check those last two notes again in my post - they're not where you have them.

[marc weber]

Originally posted by Burkhard Hassel:
...did anyone of you just google the nana? ...

Uh, that's against the terms of my probation. Besides, I'm not sure that googling the nana is legal anywhere. :roll:

[Burkhard Hassel]

Thank you, Jim now I got it:


And the midi file.



Yours,
Bu.

[David O'Meara]

I'm concerned. Google matches:

na 1,280,000,000
nana 31,800,000
nanana 796,000
nananana 243,000
nanananana 115,000
nananananana 59,800
nanananananana 29,400
nananananananana 22,800
nanananananananana 952
nananananananananana 640
nanananananananananana 3,510
nananananananananananana 2,620
nanananananananananananana 1,910
nananananananananananananana 1,330
nanananananananananananananana 1,150
nananananananananananananananana 2,020
nanananananananananananananananana 446
nananananananananananananananananana 425
nanananananananananananananananananana 588
nananananananananananananananananananana 189
nanananananananananananananananananananana 149
nananananananananananananananananananananana 210
nanananananananananananananananananananananana 70
nananananananananananananananananananananananana 111
nanananananananananananananananananananananananana 134
nananananananananananananananananananananananananana 28
nanananananananananananananananananananananananananana 34
nananananananananananananananananananananananananananana 19
nanananananananananananananananananananananananananananana 354

And then I got tired. Everyone thought the internet was full of porn, turns out it's just a place to keep your 'na's.

[David O'Meara]

and you need to go all the way to
nanananananananananananananananananananananananananananananananananananananananananananananananana
before they run out of 'na's

[marc weber]

Originally posted by David O'Meara:
I'm concerned...

As we all should be. What concerns me is that the hit numbers don't simply decrease as the length of "na" increases.

For example, there are only 640 hits for the 20-char "nananananananananana," but 3,510 hits for the 22-char "nanananananananananana." And only 19 hits for the 56-char "nananananananananananananananananananananananananananana," but 354 hits for the 58-char "nanananananananananananananananananananananananananananana."